Lineage for d1olsb1 (1ols B:2-204)
- Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds) 
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) 
there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins)
parent family to TK and PFOR
heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr moduleProtein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species) Species Human (Homo sapiens) [TaxId:9606] [88743] (21 PDB entries) 
Domain d1olsb1: 1ols B:2-204 [93332]
Other proteins in same PDB: d1olsa_, d1olsb2
complexed with gol, k, mn, tdp
Details for d1olsb1
PDB Entry: 1ols (more details), 1.85 Å
PDB Description: roles of his291-alpha and his146-beta' in the reductive acylation reaction catalyzed by human branched-chain alpha-ketoacid dehydrogenase
PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunitSCOP Domain Sequences for d1olsb1:
Sequence, based on SEQRES records: (download)
>d1olsb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
ahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglr
dkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrs
gdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscied
knpciffepkilyraaaeevpie
Sequence, based on observed residues (ATOM records): (download)
>d1olsb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
ahftfqpeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygk
drvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfn
cgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpci
ffepkilyraaaeevpie
SCOP Domain Coordinates for d1olsb1:
Click to download the PDB-style file with coordinates for d1olsb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1olsb1:
- d1olsb1 first appeared in SCOP 1.67
- d1olsb1 appears in SCOP 1.71
- d1olsb1 appears in SCOP 1.75
- d1olsb1 appears in the current release, SCOPe 2.08
View in 3D
