Lineage for d1ol7a_ (1ol7 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220122Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. 1220123Species Human (Homo sapiens) [TaxId:9606] [90039] (9 PDB entries)
  8. 1220131Domain d1ol7a_: 1ol7 A: [93312]
    complexed with adp, mg

Details for d1ol7a_

PDB Entry: 1ol7 (more details), 2.75 Å

PDB Description: structure of human aurora-a 122-403 phosphorylated on thr287, thr288
PDB Compounds: (A:) serine/threonine kinase 6

SCOPe Domain Sequences for d1ol7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ol7a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
chskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmh
dekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkh
npsqrpmlrevlehpwitansskp

SCOPe Domain Coordinates for d1ol7a_:

Click to download the PDB-style file with coordinates for d1ol7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ol7a_: