Lineage for d1okkd1 (1okk D:21-78)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765693Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 765694Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 765698Protein Signal recognition particle receptor, FtsY [47368] (3 species)
  7. 765705Species Thermus aquaticus [TaxId:271] [101122] (5 PDB entries)
  8. 765706Domain d1okkd1: 1okk D:21-78 [93261]
    Other proteins in same PDB: d1okka1, d1okka2, d1okkd2
    complexed with bzp, edo, gcp, mo3, so4

Details for d1okkd1

PDB Entry: 1okk (more details), 2.05 Å

PDB Description: homo-heterodimeric complex of the srp gtpases
PDB Compounds: (D:) cell division protein ftsy

SCOP Domain Sequences for d1okkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okkd1 a.24.13.1 (D:21-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]}
aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep

SCOP Domain Coordinates for d1okkd1:

Click to download the PDB-style file with coordinates for d1okkd1.
(The format of our PDB-style files is described here.)

Timeline for d1okkd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1okkd2