Lineage for d1okia2 (1oki A:145-236)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
sandwich; 8 strands in 2 sheets; greek-key
duplication: has internal pseudo twofold symmetrySuperfamily b.11.1: gamma-Crystallin-like [49695] (7 families) 
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) 
Protein beta-Crystallin [49702] (4 species)
duplication consists of two domains of this fold
Species Human (Homo sapiens) [TaxId:9606] [101572] (2 PDB entries) 
Domain d1okia2: 1oki A:145-236 [93256]
Details for d1okia2
PDB Entry: 1oki (more details), 1.4 Å
PDB Description: crystal structure of truncated human beta-b1-crystallin
PDB Compounds: (A:) beta crystallin b1SCOPe Domain Sequences for d1okia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1okia2 b.11.1.1 (A:145-236) beta-Crystallin {Human (Homo sapiens) [TaxId: 9606]}
aqehkislfeganfkgntieiqgddapslwvygfsdrvgsvkvssgtwvgyqypgyrgyq
yllepgdfrhwnewgafqpqmqslrrlrdkqw
SCOPe Domain Coordinates for d1okia2:
Click to download the PDB-style file with coordinates for d1okia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1okia2:
- d1okia2 first appeared in SCOP 1.67
- d1okia2 appears in SCOPe 2.06
- d1okia2 appears in the current release, SCOPe 2.08
View in 3D
