Lineage for d1okia2 (1oki A:145-236)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383151Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2383152Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2383153Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2383154Protein beta-Crystallin [49702] (4 species)
    duplication consists of two domains of this fold
  7. 2383166Species Human (Homo sapiens) [TaxId:9606] [101572] (2 PDB entries)
  8. 2383168Domain d1okia2: 1oki A:145-236 [93256]

Details for d1okia2

PDB Entry: 1oki (more details), 1.4 Å

PDB Description: crystal structure of truncated human beta-b1-crystallin
PDB Compounds: (A:) beta crystallin b1

SCOPe Domain Sequences for d1okia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okia2 b.11.1.1 (A:145-236) beta-Crystallin {Human (Homo sapiens) [TaxId: 9606]}
aqehkislfeganfkgntieiqgddapslwvygfsdrvgsvkvssgtwvgyqypgyrgyq
yllepgdfrhwnewgafqpqmqslrrlrdkqw

SCOPe Domain Coordinates for d1okia2:

Click to download the PDB-style file with coordinates for d1okia2.
(The format of our PDB-style files is described here.)

Timeline for d1okia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1okia1