Lineage for d1ok8a1 (1ok8 A:298-394)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770550Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 1770551Protein Envelope glycoprotein [49213] (5 species)
  7. 1770552Species Dengue virus type 2 [TaxId:11060] [89194] (9 PDB entries)
    Uniprot P12823 281-675 # 99% sequence identity
  8. 1770553Domain d1ok8a1: 1ok8 A:298-394 [93236]
    Other proteins in same PDB: d1ok8a2
    complexed with cl, nag

Details for d1ok8a1

PDB Entry: 1ok8 (more details), 2 Å

PDB Description: crystal structure of the dengue 2 virus envelope glycoprotein in the postfusion conformation
PDB Compounds: (A:) major envelope protein E

SCOPe Domain Sequences for d1ok8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ok8a1 b.1.18.4 (A:298-394) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

SCOPe Domain Coordinates for d1ok8a1:

Click to download the PDB-style file with coordinates for d1ok8a1.
(The format of our PDB-style files is described here.)

Timeline for d1ok8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ok8a2