Lineage for d1ok6a_ (1ok6 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species)
  7. Species Thermoproteus tenax [TaxId:2271] [102089] (5 PDB entries)
  8. Domain d1ok6a_: 1ok6 A: [93226]
    complexed with gol

Details for d1ok6a_

PDB Entry: 1ok6 (more details), 2.4 Å

PDB Description: orthorhombic crystal form of an archaeal fructose 1,6-bisphosphate aldolase
PDB Compounds: (A:) fructose-bisphosphate aldolase class I

SCOPe Domain Sequences for d1ok6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ok6a_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Thermoproteus tenax [TaxId: 2271]}
anltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfq
rgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfew
kmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikyt
gdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdal
kfaralaelvyggk

SCOPe Domain Coordinates for d1ok6a_ are not available.

Timeline for d1ok6a_:

Domains from other chains:
(mouse over for more information)
d1ok6b_, d1ok6c_, d1ok6d_, d1ok6e_, d1ok6f_, d1ok6g_, d1ok6h_, d1ok6i_, d1ok6j_