Lineage for d1ojva4 (1ojv A:191-253)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034016Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 3034131Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. 3034132Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries)
  8. 3034150Domain d1ojva4: 1ojv A:191-253 [93151]
    Other proteins in same PDB: d1ojva5, d1ojva6, d1ojvb5, d1ojvb6
    intact protein
    complexed with act, gol, so4

Details for d1ojva4

PDB Entry: 1ojv (more details), 2.3 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.
PDB Compounds: (A:) complement decay-accelerating factor

SCOPe Domain Sequences for d1ojva4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojva4 g.18.1.1 (A:191-253) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
iycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpppe
crg

SCOPe Domain Coordinates for d1ojva4:

Click to download the PDB-style file with coordinates for d1ojva4.
(The format of our PDB-style files is described here.)

Timeline for d1ojva4: