Lineage for d1oj4a2 (1oj4 A:164-283)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. Family d.58.26.5: 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89950] (1 protein)
  6. Protein 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89951] (2 species)
  7. Species Escherichia coli [TaxId:562] [103015] (2 PDB entries)
  8. Domain d1oj4a2: 1oj4 A:164-283 [93084]
    Other proteins in same PDB: d1oj4a1, d1oj4b1
    complexed with anp, cdm, cl

Details for d1oj4a2

PDB Entry: 1oj4 (more details), 2.01 Å

PDB Description: ternary complex of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase
PDB Compounds: (A:) 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase

SCOPe Domain Sequences for d1oj4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oj4a2 d.58.26.5 (A:164-283) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Escherichia coli [TaxId: 562]}
dppekwylvahpgvsiptpvifkdpelprntpkrsietllkcefsndceviarkrfrevd
avlswlleyapsrltgtgacvfaefdtesearqvleqapewlngfvakgvnlsplhraml

SCOPe Domain Coordinates for d1oj4a2 are not available.

Timeline for d1oj4a2:

Domains from same chain:
(mouse over for more information)
d1oj4a1
Domains from other chains:
(mouse over for more information)
d1oj4b1, d1oj4b2