| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
| Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
| Protein Amphibian cytotoxic ribonuclease [54084] (5 species) |
| Species Bullfrog (Rana catesbeiana), RNase6 [TaxId:8400] [110781] (2 PDB entries) Uniprot Q9DFY5 |
| Domain d1oj1a_: 1oj1 A: [103970] complexed with cg2, so4 |
PDB Entry: 1oj1 (more details), 2.1 Å
SCOPe Domain Sequences for d1oj1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oj1a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Bullfrog (Rana catesbeiana), RNase6 [TaxId: 8400]}
edwdtfqkkhltdtkkvkcdvemkkalfdckktntfifarpprvqalckniknntnvlsr
dvfylpqcnrkklpchyrldgstnticltcmkelpihfagvgkcp
Timeline for d1oj1a_: