Lineage for d1oioa_ (1oio A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767770Family b.2.3.5: F17c-type adhesin [89215] (3 proteins)
    automatically mapped to Pfam PF09222
  6. 2767781Protein Fimbrial lectin GafD [101552] (1 species)
  7. 2767782Species Escherichia coli [TaxId:562] [101553] (1 PDB entry)
  8. 2767783Domain d1oioa_: 1oio A: [93069]
    complexed with nag

Details for d1oioa_

PDB Entry: 1oio (more details), 1.7 Å

PDB Description: gafd (f17c-type) fimbrial adhesin from escherichia coli
PDB Compounds: (A:) fimbrial lectin

SCOPe Domain Sequences for d1oioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oioa_ b.2.3.5 (A:) Fimbrial lectin GafD {Escherichia coli [TaxId: 562]}
avsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrisggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndtvt

SCOPe Domain Coordinates for d1oioa_:

Click to download the PDB-style file with coordinates for d1oioa_.
(The format of our PDB-style files is described here.)

Timeline for d1oioa_: