Class b: All beta proteins [48724] (177 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
Protein Cohesin domain [49396] (2 species) |
Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (4 PDB entries) |
Domain d1ohza_: 1ohz A: [93043] Other proteins in same PDB: d1ohzb_ complexed with dockerin domain complexed with ca, cl, edo, no3 |
PDB Entry: 1ohz (more details), 2.2 Å
SCOPe Domain Sequences for d1ohza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ohza_ b.2.2.2 (A:) Cohesin domain {Clostridium thermocellum, cellulosome, various modules [TaxId: 1515]} gvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpn ptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggf adndlveqkvsfidggvnvg
Timeline for d1ohza_: