Lineage for d1ohza_ (1ohz A:)
- Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like foldSuperfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) 
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
Pfam PF00963
Protein Cohesin domain [49396] (2 species) 
Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (4 PDB entries) 
Domain d1ohza_: 1ohz A: [93043]
Other proteins in same PDB: d1ohzb_
complexed with dockerin domain
complexed with ca, cl, edo, no3
Details for d1ohza_
PDB Entry: 1ohz (more details), 2.2 Å
PDB Description: cohesin-dockerin complex from the cellulosome of clostridium thermocellum
PDB Compounds: (A:) cellulosomal scaffolding protein aSCOPe Domain Sequences for d1ohza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ohza_ b.2.2.2 (A:) Cohesin domain {Clostridium thermocellum, cellulosome, various modules [TaxId: 1515]}
gvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpn
ptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggf
adndlveqkvsfidggvnvg
SCOPe Domain Coordinates for d1ohza_:
Click to download the PDB-style file with coordinates for d1ohza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ohza_:
- d1ohza_ first appeared in SCOP 1.67
- d1ohza_ appears in SCOP 1.75
- d1ohza_ appears in SCOPe 2.02
- d1ohza_ appears in the current release, SCOPe 2.08
View in 3D
