Lineage for d1ohza_ (1ohz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767240Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 2767272Protein Cohesin domain [49396] (2 species)
  7. 2767277Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (4 PDB entries)
  8. 2767283Domain d1ohza_: 1ohz A: [93043]
    Other proteins in same PDB: d1ohzb_
    complexed with dockerin domain
    complexed with ca, cl, edo, no3

Details for d1ohza_

PDB Entry: 1ohz (more details), 2.2 Å

PDB Description: cohesin-dockerin complex from the cellulosome of clostridium thermocellum
PDB Compounds: (A:) cellulosomal scaffolding protein a

SCOPe Domain Sequences for d1ohza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohza_ b.2.2.2 (A:) Cohesin domain {Clostridium thermocellum, cellulosome, various modules [TaxId: 1515]}
gvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpn
ptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggf
adndlveqkvsfidggvnvg

SCOPe Domain Coordinates for d1ohza_:

Click to download the PDB-style file with coordinates for d1ohza_.
(The format of our PDB-style files is described here.)

Timeline for d1ohza_: