Lineage for d1ohua_ (1ohu A:)
- Root: SCOP 1.75
Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) 
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
multi-helical domains of various folds which is thought to unfold in the membrane
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) 
PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domainFamily f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins)
Pfam PF00452
Protein Apoptosis regulator ced-9 [103424] (1 species) Species Nematode (Caenorhabditis elegans) [TaxId:6239] [103425] (3 PDB entries)
Uniprot P41958 74-237
Domain d1ohua_: 1ohu A: [93029]
Details for d1ohua_
PDB Entry: 1ohu (more details), 2.03 Å
PDB Description: structure of caenorhabditis elegans ced-9
PDB Compounds: (A:) Apoptosis regulator ced-9SCOP Domain Sequences for d1ohua_:
Sequence, based on SEQRES records: (download)
>d1ohua_ f.1.4.1 (A:) Apoptosis regulator ced-9 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ndweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkhaen
fetfseqllavprisfslyqdvvrtvgnaqtdqspmsygrliglisfggfvaakmmesve
lqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek
Sequence, based on observed residues (ATOM records): (download)
>d1ohua_ f.1.4.1 (A:) Apoptosis regulator ced-9 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ndweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkhaen
fetfseqllavprisfslyqdvvrtvgnpmsygrliglisfggfvaakmmesvelqgqvr
nlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek
SCOP Domain Coordinates for d1ohua_:
Click to download the PDB-style file with coordinates for d1ohua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ohua_:
- d1ohua_ first appeared in SCOP 1.67
- d1ohua_ appears in SCOP 1.73
- d1ohua_ appears in SCOPe 2.01
- d1ohua_ appears in the current release, SCOPe 2.08
View in 3D
