Lineage for d1ohua_ (1ohu A:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886032Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 886072Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 886073Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins)
    Pfam PF00452
  6. 886102Protein Apoptosis regulator ced-9 [103424] (1 species)
  7. 886103Species Nematode (Caenorhabditis elegans) [TaxId:6239] [103425] (3 PDB entries)
    Uniprot P41958 74-237
  8. 886104Domain d1ohua_: 1ohu A: [93029]

Details for d1ohua_

PDB Entry: 1ohu (more details), 2.03 Å

PDB Description: structure of caenorhabditis elegans ced-9
PDB Compounds: (A:) Apoptosis regulator ced-9

SCOP Domain Sequences for d1ohua_:

Sequence, based on SEQRES records: (download)

>d1ohua_ f.1.4.1 (A:) Apoptosis regulator ced-9 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ndweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkhaen
fetfseqllavprisfslyqdvvrtvgnaqtdqspmsygrliglisfggfvaakmmesve
lqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek

Sequence, based on observed residues (ATOM records): (download)

>d1ohua_ f.1.4.1 (A:) Apoptosis regulator ced-9 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ndweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkhaen
fetfseqllavprisfslyqdvvrtvgnpmsygrliglisfggfvaakmmesvelqgqvr
nlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek

SCOP Domain Coordinates for d1ohua_:

Click to download the PDB-style file with coordinates for d1ohua_.
(The format of our PDB-style files is described here.)

Timeline for d1ohua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ohub_