SCOPe 2.05: Domain d1ogpa1: 1ogp A:263-389

Lineage for d1ogpa1 (1ogp A:263-389)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (24 families)
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein)
automatically mapped to Pfam PF03404
Protein Sulfite oxidase, C-terminal domain [49259] (2 species)
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101528] (1 PDB entry)
Domain d1ogpa1: 1ogp A:263-389 [92927]
Other proteins in same PDB: d1ogpa2, d1ogpb2, d1ogpc2, d1ogpd2, d1ogpe2, d1ogpf2
complexed with cs, gol, mtq

Details for d1ogpa1

PDB Entry: 1ogp (more details), 2.6 Å

PDB Description: the crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals

PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d1ogpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogpa1 b.1.18.6 (A:263-389) Sulfite oxidase, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dfpvqsaicsvedvqmvkpgkvsikgyavsgggrgiervdisldggknwveasrtqepgk
qyisehsssdkwawvlfeatidvsqtteviakavdsaanvqpenvesvwnlrgvlntswh
rvllrlg

SCOPe Domain Coordinates for d1ogpa1:

Click to download the PDB-style file with coordinates for d1ogpa1.
(The format of our PDB-style files is described here.)

Timeline for d1ogpa1: