Lineage for d1ogae2 (1oga E:119-245)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517073Protein T-cell antigen receptor [49125] (7 species)
  7. 1517104Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)
  8. 1517105Domain d1ogae2: 1oga E:119-245 [86993]
    Other proteins in same PDB: d1ogaa1, d1ogaa2, d1ogab_, d1ogad1, d1ogae1

Details for d1ogae2

PDB Entry: 1oga (more details), 1.4 Å

PDB Description: a structural basis for immunodominant human t-cell receptor recognition.
PDB Compounds: (E:) T-cell receptor beta chain c region

SCOPe Domain Sequences for d1ogae2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgradq

SCOPe Domain Coordinates for d1ogae2:

Click to download the PDB-style file with coordinates for d1ogae2.
(The format of our PDB-style files is described here.)

Timeline for d1ogae2: