Lineage for d1ofua1 (1ofu A:11-208)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361112Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1361113Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1361114Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1361115Protein Cell-division protein FtsZ [52492] (9 species)
  7. 1361160Species Pseudomonas aeruginosa [TaxId:287] [89639] (2 PDB entries)
  8. 1361161Domain d1ofua1: 1ofu A:11-208 [86972]
    Other proteins in same PDB: d1ofua2, d1ofub2, d1ofux_, d1ofuy_
    complexed with SulA homologue PA3008
    complexed with gdp

Details for d1ofua1

PDB Entry: 1ofu (more details), 2.1 Å

PDB Description: crystal structure of sula:ftsz from pseudomonas aeruginosa
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d1ofua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]}
tavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlqlgpgvtkglg
aganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaevakemgiltva
vvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasllaafakaddvl
agavrgisdiikrpgmin

SCOPe Domain Coordinates for d1ofua1:

Click to download the PDB-style file with coordinates for d1ofua1.
(The format of our PDB-style files is described here.)

Timeline for d1ofua1:

1361161
d1ofua1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ofua2