Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Myosin Essential Chain [47524] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [101181] (1 PDB entry) |
Domain d1oe9b_: 1oe9 B: [92794] Other proteins in same PDB: d1oe9a1, d1oe9a2 complexed with so4 |
PDB Entry: 1oe9 (more details), 2.05 Å
SCOPe Domain Sequences for d1oe9b_:
Sequence, based on SEQRES records: (download)
>d1oe9b_ a.39.1.5 (B:) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} fnkdqleefkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksr rvdfetflpmlqavaknrgqgtyedylegfrvfdkegngkvmgaelrhvlttlgekmtee evetvlaghedsngcinyeaflkhils
>d1oe9b_ a.39.1.5 (B:) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} fnkdqleefkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksr rvdfetflpmlqavakyedylegfrvfdgngkvmgaelrhvlttlgekmteeevetvlag hedsngcinyeaflkhils
Timeline for d1oe9b_: