Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
Protein N-terminal domain of sialoadhesin [48732] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [48733] (7 PDB entries) |
Domain d1od7a_: 1od7 A: [86837] complexed with suw |
PDB Entry: 1od7 (more details), 3 Å
SCOP Domain Sequences for d1od7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1od7a_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd
Timeline for d1od7a_: