Lineage for d1od2a2 (1od2 A:1815-2203)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853345Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2853352Protein Acetyl-coenzyme A carboxylase, C-terminal domain [418957] (1 species)
    protein duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 2853353Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419417] (8 PDB entries)
    Uniprot Q00955
  8. 2853371Domain d1od2a2: 1od2 A:1815-2203 [86822]
    Other proteins in same PDB: d1od2a1, d1od2b1
    complexed with aco, ade
    has additional insertions and/or extensions that are not grouped together

Details for d1od2a2

PDB Entry: 1od2 (more details), 2.7 Å

PDB Description: acetyl-coa carboxylase carboxyltransferase domain
PDB Compounds: (A:) acetyl-coenzyme a carboxylase

SCOPe Domain Sequences for d1od2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1od2a2 c.14.1.4 (A:1815-2203) Acetyl-coenzyme A carboxylase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlddkyrel
rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele
wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
ieenyktlddklkglklesfaqdlakkir

SCOPe Domain Coordinates for d1od2a2:

Click to download the PDB-style file with coordinates for d1od2a2.
(The format of our PDB-style files is described here.)

Timeline for d1od2a2:

2853371
d1od2a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1od2a1