Lineage for d1ocxa_ (1ocx A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806519Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1806520Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1806555Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
    this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain
  6. 1806570Protein Maltose O-acetyltransferase [89400] (1 species)
  7. 1806571Species Escherichia coli [TaxId:562] [89401] (1 PDB entry)
  8. 1806572Domain d1ocxa_: 1ocx A: [86814]
    complexed with pbm

Details for d1ocxa_

PDB Entry: 1ocx (more details), 2.15 Å

PDB Description: e. coli maltose-o-acetyltransferase
PDB Compounds: (A:) maltose o-acetyltransferase

SCOPe Domain Sequences for d1ocxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]}
stekekmiagelyrsadetlsrdrlrarqlihrynhslaeehtlrqqiladlfgqvteay
ieptfrcdygyniflgnnffanfdcvmldvcpirigdncmlapgvhiytathpidpvarn
sgaelgkpvtignnvwiggravinpgvtigdnvvvasgavvtkdvpdnvvvggnpariik
kl

SCOPe Domain Coordinates for d1ocxa_:

Click to download the PDB-style file with coordinates for d1ocxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ocxa_: