Lineage for d1ocka_ (1ock A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the restSuperfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) 
automatically mapped to Pfam PF01425Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 proteins) 
Protein Malonamidase E2 [75306] (1 species) Species Bradyrhizobium japonicum [TaxId:375] [75307] (15 PDB entries) 
Domain d1ocka_: 1ock A: [86802]
Details for d1ocka_
PDB Entry: 1ock (more details), 1.8 Å
PDB Description: the crystal structure of malonamidase e2 from bradyrhizobium japonicum
PDB Compounds: (A:) malonamidase e2SCOPe Domain Sequences for d1ocka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]}
misladlqrrietgelspnaaiaqshaaiearekevhafvrhdksaraqasgplrgiavg
ikdiidtanmptemgseiyrgwqprsdapvvmmlkragatiigkttttafasrdptatln
phntghspggsssgsaaavgagmiplalgtqtggsvirpaaycgtaaikpsfrmlptvgv
kcyswaldtvglfgaraedlargllamtgrsefsgivpakaprigvvrqefagavepaae
qglqaaikaaeragasvqaidlpeavheawrihpiiqdfeahralawefsehhdeiapml
rasldatvgltpkeydearrigrrgrrelgevfegvdvlltysapgtapakalastgdpr
ynrlwtlmgnpcvnvpvlkvgglpigvqviarfgndahalatawfledalak
SCOPe Domain Coordinates for d1ocka_:
Click to download the PDB-style file with coordinates for d1ocka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ocka_:
- d1ocka_ first appeared in SCOP 1.65
- d1ocka_ appears in SCOPe 2.07
View in 3D
