Lineage for d1obzb1 (1obz B:108-194)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538457Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1538458Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1538459Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1538697Protein Syntenin 1 [89311] (1 species)
  7. 1538698Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)
  8. 1538708Domain d1obzb1: 1obz B:108-194 [86788]
    tandem of two PDZ domains; complexed with an interleukin 5 receptor alpha peptide, chain P
    complexed with act

Details for d1obzb1

PDB Entry: 1obz (more details), 1.69 Å

PDB Description: crystal structure of the complex of the pdz tandem of syntenin with an interleukin 5 receptor alpha peptide.
PDB Compounds: (B:) Syntenin 1

SCOPe Domain Sequences for d1obzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obzb1 b.36.1.1 (B:108-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
gamdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingenca
gwssdkahkvlkqafgekitmtirdrp

SCOPe Domain Coordinates for d1obzb1:

Click to download the PDB-style file with coordinates for d1obzb1.
(The format of our PDB-style files is described here.)

Timeline for d1obzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1obzb2