Lineage for d1ob3a_ (1ob3 A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
CMGC group; CDKs subfamily; serine/threonine kinase
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [103289] (4 PDB entries)
CDK2 homologue Pfpk5
Domain d1ob3a_: 1ob3 A: [92747]
Details for d1ob3a_
PDB Entry: 1ob3 (more details), 1.9 Å
PDB Description: structure of p. falciparum pfpk5
PDB Compounds: (A:) cell division control protein 2 homologSCOPe Domain Sequences for d1ob3a_:
Sequence, based on SEQRES records: (download)
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mekyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhs
nivklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrr
vlhrdlkpqnllinregelkiadfglarafgipvrkytheivtlwyrapdvlmgskkyst
tidiwsvgcifaemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftv
yeplpwesflkgldesgidllskmlkldpnqritakqalehayfke
Sequence, based on observed residues (ATOM records): (download)
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mekyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhs
nivklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrr
vlhrdlkpqnllinregelkiadfglarafgivtlwyrapdvlmgskkysttidiwsvgc
ifaemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftvyeplpwesf
lkgldesgidllskmlkldpnqritakqalehayfke
SCOPe Domain Coordinates for d1ob3a_:
Click to download the PDB-style file with coordinates for d1ob3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ob3a_:
- d1ob3a_ first appeared in SCOP 1.67
- d1ob3a_ appears in SCOPe 2.03
- d1ob3a_ appears in SCOPe 2.05
- d1ob3a_ appears in the current release, SCOPe 2.08
View in 3D
