Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species) |
Species Salmonella typhimurium [TaxId:90371] [53691] (3 PDB entries) |
Domain d1oasa_: 1oas A: [35293] complexed with plp |
PDB Entry: 1oas (more details), 2.2 Å
SCOPe Domain Sequences for d1oasa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oasa_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps sgerylstalfadlf
Timeline for d1oasa_: