Lineage for d1o97c_ (1o97 C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2119957Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2120107Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 2120129Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
    binds AMP
  7. 2120134Species Methylophilus methylotrophus [TaxId:17] [82363] (8 PDB entries)
  8. 2120136Domain d1o97c_: 1o97 C: [81232]
    Other proteins in same PDB: d1o97d1, d1o97d2
    complexed with amp, fad

Details for d1o97c_

PDB Entry: 1o97 (more details), 1.6 Å

PDB Description: structure of electron transferring flavoprotein from methylophilus methylotrophus, recognition loop removed by limited proteolysis
PDB Compounds: (C:) electron transferring flavoprotein beta-subunit

SCOPe Domain Sequences for d1o97c_:

Sequence, based on SEQRES records: (download)

>d1o97c_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipekgra
tmiegtiseqaakiiqiinef

Sequence, based on observed residues (ATOM records): (download)

>d1o97c_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryaspieevsladiglsandvgaaqsmsrvrrmyipekgratmiegtiseq
aakiiqiinef

SCOPe Domain Coordinates for d1o97c_:

Click to download the PDB-style file with coordinates for d1o97c_.
(The format of our PDB-style files is described here.)

Timeline for d1o97c_: