Lineage for d1o87a1 (1o87 A:1-88)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) 
Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) Protein Signal sequence recognition protein Ffh [47366] (3 species) Species Thermus aquaticus [TaxId:271] [47367] (16 PDB entries) 
Domain d1o87a1: 1o87 A:1-88 [92640]
Other proteins in same PDB: d1o87a2, d1o87b2
protein/RNA complex; complexed with cl, fmt, gdp, mg
Details for d1o87a1
PDB Entry: 1o87 (more details), 2.1 Å
PDB Description: a new mggdp complex of the ffh ng domain
PDB Compounds: (A:) signal recognition particle proteinSCOPe Domain Sequences for d1o87a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o87a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg
SCOPe Domain Coordinates for d1o87a1:
Click to download the PDB-style file with coordinates for d1o87a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o87a1:
- d1o87a1 first appeared in SCOP 1.67
- d1o87a1 appears in SCOPe 2.07
View in 3D
