Lineage for d1o7nb_ (1o7n B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936608Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2936620Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)
  7. 2936621Species Pseudomonas putida [TaxId:303] [54440] (10 PDB entries)
  8. 2936625Domain d1o7nb_: 1o7n B: [81164]
    Other proteins in same PDB: d1o7na1, d1o7na2
    complexed with edo, fe, fes, ind, oxy, so4

Details for d1o7nb_

PDB Entry: 1o7n (more details), 1.4 Å

PDB Description: naphthalene 1,2-dioxygenase, ternary complex with dioxygen and indole
PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d1o7nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7nb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida [TaxId: 303]}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

SCOPe Domain Coordinates for d1o7nb_:

Click to download the PDB-style file with coordinates for d1o7nb_.
(The format of our PDB-style files is described here.)

Timeline for d1o7nb_: