Lineage for d1o7na2 (1o7n A:155-448)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.129: TBP-like [55944] (11 superfamilies)
beta-alpha-beta(4)-alphaSuperfamily d.129.3: Bet v1-like [55961] (11 families) 
contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species) Species Pseudomonas putida [TaxId:303] [55971] (10 PDB entries) 
Domain d1o7na2: 1o7n A:155-448 [81163]
Other proteins in same PDB: d1o7na1, d1o7nb_
complexed with edo, fe, fes, ind, oxy, so4
Details for d1o7na2
PDB Entry: 1o7n (more details), 1.4 Å
PDB Description: naphthalene 1,2-dioxygenase, ternary complex with dioxygen and indole
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunitSCOPe Domain Sequences for d1o7na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o7na2 d.129.3.3 (A:155-448) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida [TaxId: 303]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkttd
SCOPe Domain Coordinates for d1o7na2:
Click to download the PDB-style file with coordinates for d1o7na2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o7na2:
- d1o7na2 first appeared in SCOP 1.63
- d1o7na2 appears in SCOPe 2.04
- d1o7na2 appears in SCOPe 2.06
- d1o7na2 appears in the current release, SCOPe 2.08
View in 3D
