Lineage for d1o7na1 (1o7n A:1-154)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782956Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1782957Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1783075Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 1783107Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (4 species)
  7. 1783108Species Pseudomonas putida [TaxId:303] [50035] (10 PDB entries)
  8. 1783109Domain d1o7na1: 1o7n A:1-154 [81162]
    Other proteins in same PDB: d1o7na2, d1o7nb_
    complexed with edo, fe, fes, ind, oxy, so4

Details for d1o7na1

PDB Entry: 1o7n (more details), 1.4 Å

PDB Description: naphthalene 1,2-dioxygenase, ternary complex with dioxygen and indole
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOPe Domain Sequences for d1o7na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7na1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida [TaxId: 303]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

SCOPe Domain Coordinates for d1o7na1:

Click to download the PDB-style file with coordinates for d1o7na1.
(The format of our PDB-style files is described here.)

Timeline for d1o7na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o7na2
View in 3D
Domains from other chains:
(mouse over for more information)
d1o7nb_