Lineage for d1o6sb_ (1o6s B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936638Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 936639Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 936647Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 936648Species Human (Homo sapiens) [TaxId:9606] [81981] (9 PDB entries)
  8. 936653Domain d1o6sb_: 1o6s B: [81096]
    Other proteins in same PDB: d1o6sa1, d1o6sa2
    domain 1
    complexed with ca, cl

Details for d1o6sb_

PDB Entry: 1o6s (more details), 1.8 Å

PDB Description: internalin (listeria monocytogenes) / e-cadherin (human) recognition complex
PDB Compounds: (B:) e-cadherin

SCOPe Domain Sequences for d1o6sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6sb_ b.1.6.1 (B:) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
gplgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiiere
tgwlkvtepldreriatytlfshavssngnavedpmeilitvtdq

SCOPe Domain Coordinates for d1o6sb_:

Click to download the PDB-style file with coordinates for d1o6sb_.
(The format of our PDB-style files is described here.)

Timeline for d1o6sb_: