Lineage for d1o6sa1 (1o6s A:417-496)
- Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (20 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
truncated fold fused to an LRR domain
Protein Internalin A [81973] (1 species) Species Listeria monocytogenes [TaxId:1639] [81974] (6 PDB entries) 
Domain d1o6sa1: 1o6s A:417-496 [81094]
Other proteins in same PDB: d1o6sa2, d1o6sb_
complexed with ca, cl
Details for d1o6sa1
PDB Entry: 1o6s (more details), 1.8 Å
PDB Description: internalin (listeria monocytogenes) / e-cadherin (human) recognition complex
PDB Compounds: (A:) internalin aSCOP Domain Sequences for d1o6sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o6sa1 b.1.18.15 (A:417-496) Internalin A {Listeria monocytogenes [TaxId: 1639]}
wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp
vtigkgtttfsgtvtqplka
SCOP Domain Coordinates for d1o6sa1:
Click to download the PDB-style file with coordinates for d1o6sa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o6sa1:
- d1o6sa1 first appeared in SCOP 1.63
- d1o6sa1 appears in SCOP 1.71
- d1o6sa1 appears in SCOP 1.75
- d1o6sa1 appears in the current release, SCOPe 2.08
View in 3D
