Lineage for d1o6ka_ (1o6k A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588980Protein Pkb kinase (Akt-2) [82791] (1 species)
    AGC group; RAC/Akt subfamily; serine/threonine kinase
  7. 2588981Species Human (Homo sapiens) [TaxId:9606] [82792] (16 PDB entries)
  8. 2588984Domain d1o6ka_: 1o6k A: [81091]
    complexed with anp, mn

Details for d1o6ka_

PDB Entry: 1o6k (more details), 1.7 Å

PDB Description: structure of activated form of pkb kinase domain s474d with gsk3 peptide and amp-pnp
PDB Compounds: (A:) rac-beta serine/threonine protein kinase

SCOPe Domain Sequences for d1o6ka_:

Sequence, based on SEQRES records: (download)

>d1o6ka_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
qsititppdrydslglleldqrthfpqfdysasi

Sequence, based on observed residues (ATOM records): (download)

>d1o6ka_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
qsitqrthfpqfdysasi

SCOPe Domain Coordinates for d1o6ka_:

Click to download the PDB-style file with coordinates for d1o6ka_.
(The format of our PDB-style files is described here.)

Timeline for d1o6ka_: