Lineage for d1o6ba_ (1o6b A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 984755Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 984756Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 984996Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 985101Protein Phosphopantetheine adenylyltransferase [52398] (5 species)
  7. 985102Species Bacillus subtilis [TaxId:1423] [102259] (1 PDB entry)
  8. 985103Domain d1o6ba_: 1o6b A: [92564]
    structural genomics
    complexed with adp, cl, mg, po4

Details for d1o6ba_

PDB Entry: 1o6b (more details), 2.2 Å

PDB Description: crystal structure of phosphopantetheine adenylyltransferase with adp
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d1o6ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]}
asiavcpgsfdpvtyghldiikrgahifeqvyvcvlnnsskkplfsveercellrevtkd
ipnitvetsqgllidyarrknakailrglravsdfeyemqgtsvnrvldesietffmman
nqysflsssivkevarydgsvsefvppevelalqqkfrqggsh

SCOPe Domain Coordinates for d1o6ba_:

Click to download the PDB-style file with coordinates for d1o6ba_.
(The format of our PDB-style files is described here.)

Timeline for d1o6ba_: