Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Phosphopantetheine adenylyltransferase [52398] (6 species) |
Species Bacillus subtilis [TaxId:1423] [102259] (1 PDB entry) |
Domain d1o6ba_: 1o6b A: [92564] structural genomics complexed with adp, cl, mg, po4 |
PDB Entry: 1o6b (more details), 2.2 Å
SCOPe Domain Sequences for d1o6ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} asiavcpgsfdpvtyghldiikrgahifeqvyvcvlnnsskkplfsveercellrevtkd ipnitvetsqgllidyarrknakailrglravsdfeyemqgtsvnrvldesietffmman nqysflsssivkevarydgsvsefvppevelalqqkfrqggsh
Timeline for d1o6ba_: