Lineage for d1o5ia_ (1o5i A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841624Protein beta-keto acyl carrier protein reductase [51788] (8 species)
  7. 2841670Species Thermotoga maritima [TaxId:2336] [102150] (1 PDB entry)
    TM1169
  8. 2841671Domain d1o5ia_: 1o5i A: [92499]
    structural genomics
    complexed with nad

Details for d1o5ia_

PDB Entry: 1o5i (more details), 2.5 Å

PDB Description: crystal structure of 3-oxoacyl-(acyl carrier protein) reductase (tm1169) from thermotoga maritima at 2.50 a resolution
PDB Compounds: (A:) 3-oxoacyl-(acyl carrier protein) reductase

SCOPe Domain Sequences for d1o5ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]}
girdkgvlvlaasrgigravadvlsqegaevticarneellkrsghryvvcdlrkdldll
fekvkevdilvlnaggpkagffdeltnedfkeaidslflnmikivrnylpamkekgwgri
vaitsfsvispienlytsnsarmaltgflktlsfevapygitvncvapgwtetervkell
seekkkqvesqipmrrmakpeeiasvvaflcsekasyltgqtivvdgglskfpl

SCOPe Domain Coordinates for d1o5ia_:

Click to download the PDB-style file with coordinates for d1o5ia_.
(The format of our PDB-style files is described here.)

Timeline for d1o5ia_: