Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries) Uniprot P13726 33-242 |
Domain d1o5dt2: 1o5d T:107-205 [103884] Other proteins in same PDB: d1o5dh_, d1o5dl1, d1o5dl2 complexed with cr9 |
PDB Entry: 1o5d (more details), 2.05 Å
SCOPe Domain Sequences for d1o5dt2:
Sequence, based on SEQRES records: (download)
>d1o5dt2 b.1.2.1 (T:107-205) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk taktntneflidvdkgenycfsvqavipsrtvnrkstds
>d1o5dt2 b.1.2.1 (T:107-205) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} nlgdertlvrrnntflslrdvfgkdliytlyysvqavipsrtvnrkstds
Timeline for d1o5dt2: