Lineage for d1o5dt2 (1o5d T:107-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761786Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2761787Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
    Uniprot P13726 33-242
  8. 2761830Domain d1o5dt2: 1o5d T:107-205 [103884]
    Other proteins in same PDB: d1o5dh_, d1o5dl1, d1o5dl2
    complexed with cr9
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1o5dt2

PDB Entry: 1o5d (more details), 2.05 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1o5dt2:

Sequence, based on SEQRES records: (download)

>d1o5dt2 b.1.2.1 (T:107-205) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstds

Sequence, based on observed residues (ATOM records): (download)

>d1o5dt2 b.1.2.1 (T:107-205) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgdertlvrrnntflslrdvfgkdliytlyysvqavipsrtvnrkstds

SCOPe Domain Coordinates for d1o5dt2:

Click to download the PDB-style file with coordinates for d1o5dt2.
(The format of our PDB-style files is described here.)

Timeline for d1o5dt2:

2761830
d1o5dt2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1o5dt1