Lineage for d1o26a_ (1o26 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) 
automatically mapped to Pfam PF02511Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins) Protein Thy1 homologue [69798] (1 species) Species Thermotoga maritima [TaxId:2336] [69799] (22 PDB entries)
TM0449
Domain d1o26a_: 1o26 A: [86566]
structural genomics
complexed with fad, pge, ump
Details for d1o26a_
PDB Entry: 1o26 (more details), 1.6 Å
PDB Description: crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and dump at 1.6 a resolution
PDB Compounds: (A:) Thymidylate synthase thyXSCOPe Domain Sequences for d1o26a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o26a_ d.207.1.1 (A:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
hhmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfe
hivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttipperv
tekiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradsh
aqweiqqyalaiarifkekcpwtfeaflkyaykgdilke
SCOPe Domain Coordinates for d1o26a_:
Click to download the PDB-style file with coordinates for d1o26a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o26a_:
- d1o26a_ first appeared in SCOP 1.65
- d1o26a_ appears in SCOPe 2.04
- d1o26a_ is called d1o26a1 in SCOPe 2.06
- d1o26a_ appears in the current release, SCOPe 2.08, called d1o26a1
View in 3D
