Lineage for d1o1za_ (1o1z A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1825748Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 1825803Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 proteins)
    Pfam PF03009
  6. 1825815Protein Hypothetical protein TM1621 [89509] (1 species)
  7. 1825816Species Thermotoga maritima [TaxId:2336] [89510] (1 PDB entry)
  8. 1825817Domain d1o1za_: 1o1z A: [86555]
    structural genomics
    complexed with na

Details for d1o1za_

PDB Entry: 1o1z (more details), 1.6 Å

PDB Description: crystal structure of glycerophosphodiester phosphodiesterase (gdpd) (tm1621) from thermotoga maritima at 1.60 a resolution
PDB Compounds: (A:) glycerophosphodiester phosphodiesterase

SCOPe Domain Sequences for d1o1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1za_ c.1.18.3 (A:) Hypothetical protein TM1621 {Thermotoga maritima [TaxId: 2336]}
hhhhvivlghrgysakylentleafmkaieagangveldvrlskdgkvvvshdedlkrlf
gldvkirdatvselkeltdgkittlkevfenvsddkiinieikereaadavleiskkrkn
lifssfdldlldekfkgtkygylideenygsienfvervekerpyslhvpyqafeleyav
evlrsfrkkgivifvwtlndpeiyrkirreidgvitdevelfvklr

SCOPe Domain Coordinates for d1o1za_:

Click to download the PDB-style file with coordinates for d1o1za_.
(The format of our PDB-style files is described here.)

Timeline for d1o1za_: