Lineage for d1o17a1 (1o17 A:1-70)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1271519Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 1271530Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family) (S)
    automatically mapped to Pfam PF02885
  5. 1271531Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 1271532Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)
  7. 1271540Species Sulfolobus solfataricus [TaxId:2287] [81775] (6 PDB entries)
  8. 1271541Domain d1o17a1: 1o17 A:1-70 [80765]
    Other proteins in same PDB: d1o17a2, d1o17b2, d1o17c2, d1o17d2

Details for d1o17a1

PDB Entry: 1o17 (more details), 2.05 Å

PDB Description: anthranilate phosphoribosyl-transferase (trpd)
PDB Compounds: (A:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1o17a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o17a1 a.46.2.1 (A:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Sulfolobus solfataricus [TaxId: 2287]}
mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
amrelaikid

SCOPe Domain Coordinates for d1o17a1:

Click to download the PDB-style file with coordinates for d1o17a1.
(The format of our PDB-style files is described here.)

Timeline for d1o17a1:

1271541
d1o17a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1o17a2