![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily) sandwich; 6 strands in 2 sheets |
![]() | Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) ![]() |
![]() | Family b.105.1.1: PBP5 C-terminal domain-like [69190] (2 proteins) automatically mapped to Pfam PF07943 |
![]() | Protein Penicillin-binding protein 5, C-terminal domain [69191] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [69192] (11 PDB entries) |
![]() | Domain d1nzoa1: 1nzo A:263-355 [92383] Other proteins in same PDB: d1nzoa2 complexed with bme |
PDB Entry: 1nzo (more details), 1.85 Å
SCOPe Domain Sequences for d1nzoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nzoa1 b.105.1.1 (A:263-355) Penicillin-binding protein 5, C-terminal domain {Escherichia coli [TaxId: 562]} fetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdlkasyvlnsselhap lqknqvvgtinfqldgktieqrplvvlqeipeg
Timeline for d1nzoa1: