Lineage for d1nzoa1 (1nzo A:263-355)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1811682Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 1811683Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. 1811684Family b.105.1.1: PBP5 C-terminal domain-like [69190] (2 proteins)
    automatically mapped to Pfam PF07943
  6. 1811691Protein Penicillin-binding protein 5, C-terminal domain [69191] (1 species)
  7. 1811692Species Escherichia coli [TaxId:562] [69192] (11 PDB entries)
  8. 1811696Domain d1nzoa1: 1nzo A:263-355 [92383]
    Other proteins in same PDB: d1nzoa2
    complexed with bme

Details for d1nzoa1

PDB Entry: 1nzo (more details), 1.85 Å

PDB Description: The crystal structure of wild type penicillin-binding protein 5 from E. coli
PDB Compounds: (A:) penicillin-binding protein 5

SCOPe Domain Sequences for d1nzoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzoa1 b.105.1.1 (A:263-355) Penicillin-binding protein 5, C-terminal domain {Escherichia coli [TaxId: 562]}
fetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdlkasyvlnsselhap
lqknqvvgtinfqldgktieqrplvvlqeipeg

SCOPe Domain Coordinates for d1nzoa1:

Click to download the PDB-style file with coordinates for d1nzoa1.
(The format of our PDB-style files is described here.)

Timeline for d1nzoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nzoa2