Lineage for d1nysa_ (1nys A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962063Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1962064Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1962288Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 1962339Protein Type II activin receptor [57357] (3 species)
  7. 1962350Species Norway rat (Rattus norvegicus) [TaxId:10116] [90154] (2 PDB entries)
  8. 1962351Domain d1nysa_: 1nys A: [86413]
    Other proteins in same PDB: d1nysb_, d1nysd_
    complexed with activin A

Details for d1nysa_

PDB Entry: 1nys (more details), 3.05 Å

PDB Description: crystal structure of activin a bound to the ecd of actriib p41
PDB Compounds: (A:) activin receptor

SCOPe Domain Sequences for d1nysa_:

Sequence, based on SEQRES records: (download)

>d1nysa_ g.7.1.3 (A:) Type II activin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
etreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfnc
ydrqecvateenpqvyfcccegnfcnerfthlp

Sequence, based on observed residues (ATOM records): (download)

>d1nysa_ g.7.1.3 (A:) Type II activin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
etreciyynanwelertnqsglercegdkrlhcyaswrnssgtielvkkgcwlddfncyd
rqecvateenpqvyfcccegnfcnerfthlp

SCOPe Domain Coordinates for d1nysa_:

Click to download the PDB-style file with coordinates for d1nysa_.
(The format of our PDB-style files is described here.)

Timeline for d1nysa_: