Lineage for d1nyka_ (1nyk A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)Superfamily b.33.1: ISP domain [50022] (4 families) 
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) 
Protein Soluble Rieske protein [89291] (1 species) Species Thermus thermophilus [TaxId:274] [89292] (1 PDB entry) 
Domain d1nyka_: 1nyk A: [86408]
complexed with fes, mg
Details for d1nyka_
PDB Entry: 1nyk (more details), 1.31 Å
PDB Description: Crystal Structure of the Rieske protein from Thermus thermophilus
PDB Compounds: (A:) Rieske iron-sulfur proteinSCOPe Domain Sequences for d1nyka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nyka_ b.33.1.1 (A:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]}
tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv
arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq
viagppprpvpqlpvrvedgvlvaageflgpvgvqa
SCOPe Domain Coordinates for d1nyka_:
Click to download the PDB-style file with coordinates for d1nyka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nyka_:
- d1nyka_ first appeared in SCOP 1.65
- d1nyka_ appears in SCOPe 2.04
- d1nyka_ appears in SCOPe 2.06
- d1nyka_ appears in the current release, SCOPe 2.08
View in 3D
