Lineage for d1nyca_ (1nyc A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674421Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (2 families) (S)
  5. 674428Family b.61.2.2: Staphostatin [101869] (2 proteins)
    cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand
  6. 674432Protein Staphostatin B (SspC) [101872] (1 species)
  7. 674433Species Staphylococcus aureus [TaxId:1280] [101873] (4 PDB entries)
  8. 674434Domain d1nyca_: 1nyc A: [92336]

Details for d1nyca_

PDB Entry: 1nyc (more details), 1.4 Å

PDB Description: Staphostatins resemble lipocalins, not cystatins in fold.
PDB Compounds: (A:) cysteine protease Inhibitor

SCOP Domain Sequences for d1nyca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyca_ b.61.2.2 (A:) Staphostatin B (SspC) {Staphylococcus aureus [TaxId: 1280]}
gsmyqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfi
dtahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv

SCOP Domain Coordinates for d1nyca_:

Click to download the PDB-style file with coordinates for d1nyca_.
(The format of our PDB-style files is described here.)

Timeline for d1nyca_: