Lineage for d1ny721 (1ny7 2:1-182)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) 
Family b.121.4.2: Comoviridae-like VP [88636] (3 proteins)
duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chainsProtein Comovirus coat proteins (VP37 and VP23) [49627] (2 species)
chain 1 is one-domain VP23; chain 2 is two-domain VP37
Species CPMV (Cowpea mosaic virus) [TaxId:12264] [89227] (2 PDB entries) 
Domain d1ny721: 1ny7 2:1-182 [86399]
Details for d1ny721
PDB Entry: 1ny7 (more details), 3 Å
PDB Description: cowpea mosaic virus (cpmv)
PDB Compounds: (2:) cowpea mosaic virus, large (l) subunitSCOPe Domain Sequences for d1ny721:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ny721 b.121.4.2 (2:1-182) Comovirus coat proteins (VP37 and VP23) {CPMV (Cowpea mosaic virus) [TaxId: 12264]}
meqnlfalslddtssvrgslldtkfaqtrvllskamaggdvlldeylydvvngqdfratv
aflrthvitgkikvtattnisdnsgcclmlainsgvrgkystdvyticsqdsmtwnpgck
knfsftfnpnpcgdswsaemisrsrvrmtvicvsgwtlspttdviakldwsivnekcept
iy
SCOPe Domain Coordinates for d1ny721:
Click to download the PDB-style file with coordinates for d1ny721.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ny721:
- d1ny721 first appeared in SCOP 1.65
- d1ny721 appears in SCOPe 2.05
- d1ny721 appears in SCOPe 2.07
- d1ny721 appears in the current release, SCOPe 2.08
View in 3D
