Lineage for d1nxfa_ (1nxf A:)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.2: Globins [46463] (27 proteins)
Heme-binding protein
Protein Hemoglobin I [46464] (2 species) Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (36 PDB entries) 
Domain d1nxfa_: 1nxf A: [92298]
complexed with cmo, hem
Details for d1nxfa_
PDB Entry: 1nxf (more details), 1.85 Å
PDB Description: ligand-linked transitions of deoxyhbi crystals exposed to co.
PDB Compounds: (A:) Globin ISCOPe Domain Sequences for d1nxfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nxfa_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal
SCOPe Domain Coordinates for d1nxfa_:
Click to download the PDB-style file with coordinates for d1nxfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nxfa_:
- d1nxfa_ first appeared in SCOP 1.67
- d1nxfa_ appears in SCOPe 2.02
- d1nxfa_ appears in SCOPe 2.04
- d1nxfa_ appears in the current release, SCOPe 2.08
View in 3D
