Lineage for d1nxea_ (1nxe A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.103: Citrate synthase [48255] (1 superfamily)
multihelical; consists of two all-alpha domainsSuperfamily a.103.1: Citrate synthase [48256] (2 families) 
Family a.103.1.1: Citrate synthase [48257] (2 proteins)
duplication: large domain consists of two structural repeats
the second repeat is interrupted by the small domain
automatically mapped to Pfam PF00285Protein Citrate synthase [48258] (7 species) 
Species Escherichia coli [TaxId:562] [81862] (12 PDB entries)
Uniprot P00891
Domain d1nxea_: 1nxe A: [86377]
complexed with so4
Details for d1nxea_
PDB Entry: 1nxe (more details), 2.3 Å
PDB Description: a novel nadh allosteric regulator site is found on the surface of the hexameric type ii phe383ala variant of citrate synthase
PDB Compounds: (A:) citrate synthaseSCOPe Domain Sequences for d1nxea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nxea_ a.103.1.1 (A:) Citrate synthase {Escherichia coli [TaxId: 562]}
adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftstasceskitfid
gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl
fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
agssganpfaciaagiaslwgpahgganeaalkmleeissvkhipeffrrakdkndsfrl
mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
vdfysgiilkamgipssmftviaamartvgwiahwsemhsdgmkiarprqlytgyekrdf
ksdikr
SCOPe Domain Coordinates for d1nxea_:
Click to download the PDB-style file with coordinates for d1nxea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nxea_:
- d1nxea_ first appeared in SCOP 1.65
- d1nxea_ appears in SCOPe 2.07
View in 3D
