Lineage for d1nx9a2 (1nx9 A:50-434)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1003552Family c.69.1.21: PepX catalytic domain-like [69581] (3 proteins)
  6. 1003553Protein Alpha-amino acid ester hydrolase [89769] (2 species)
  7. 1003554Species Acetobacter pasteurianus [TaxId:438] [102619] (4 PDB entries)
  8. 1003571Domain d1nx9a2: 1nx9 A:50-434 [92286]
    Other proteins in same PDB: d1nx9a1, d1nx9b1, d1nx9c1, d1nx9d1
    complexed with aic, gol; mutant

Details for d1nx9a2

PDB Entry: 1nx9 (more details), 2.2 Å

PDB Description: acetobacter turbidans alpha-amino acid ester hydrolase s205a mutant complexed with ampicillin
PDB Compounds: (A:) alpha-amino acid ester hydrolase

SCOPe Domain Sequences for d1nx9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nx9a2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
hdplsvqtgsdipasvhmptdqqrdyikrevmvpmrdgvklytvivipknarnapilltr
tpynakgranrvpnaltmrevlpqgddvfveggyirvfqdirgkygsqgdyvmtrpphgp
lnptktdettdawdtvdwlvhnvpesngrvgmtgsayegftvvmalldphpalkvaapes
pmvdgwmgddwfhygafrqgafdyfvsqmtargggndiprrdaddytnflkagsagsfat
qagldqypfwqrmhahpaydafwqgqaldkilaqrkptvpmlweqglwdqedmwgaihaw
qalkdadvkapntlvmgpwrhsgvnyngstlgplefegdtahqyrrdvfrpffdeylkpg
sasvhlpdaiiyntgdqkwdyyrsw

SCOPe Domain Coordinates for d1nx9a2:

Click to download the PDB-style file with coordinates for d1nx9a2.
(The format of our PDB-style files is described here.)

Timeline for d1nx9a2: